dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427712430|ref|YP_007061054.1| (Synechococcus sp. PCC 6312)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment membrane protease FtsH catalytic subunit [Synechococcus sp. PCC 6312]
Sequence length 612
Sequence
MNKRWRNAGLYVLLTIVVLALATAFFDRQPTTKVTWRYSELIQEVENHQVAKLNISPDRT
QAQAVTQDGTRVLVNLPPDPQLIDILTANNVDISVMPQNNDGFWFRALSSLLVPVALLVL
LFFLLRRAQGGAGNQAMSFGKSKARVQMEPQTQITFNDVAGIDQAKLELTEVVDFLKNAD
KFTEIGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVRD
LFEQAKSNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGIIIIA
ATNRPDVLDAALMRPGRFDRQVVVDRPDYKGRLEILKVHARGKTLAKDVDLDKISRRSPG
FTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVMAGPEKKDRVMSERRKTLVAYHE
AGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEEQMDSGLYSRAYLQNQMAVALGG
RIAEEIVFGEDEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQNGNVFLGRDIM
AERDFSEETAATIDDEVRNLVDQAYRRAKDVLVSNRHVLDKIAEILITKETIDAEELQEI
LDSTEVKMAAIA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]