dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|501145766|ref|YP_007986104.1| (Lactobacillus plantarum subsp. plantarum P-8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA(Ile)-lysidine synthase [Lactobacillus plantarum subsp. plantarum P-8]
Sequence length 448
Sequence
MTPIQKFNRQLAAAKLLSPQQTVVVAVSTGVDSMVLLHLLQRLPAVERPRVVVAHVNHHL
REQSQMEADYLRQYCQQQNLKLVMADWLPAAHPKSGIEAAGRQFRYHVFAKVMRENRATA
VLTAHHANDQVETYLMKLARGGDISQLTGIATSRPFATGRLIRPLLTWSKDQLRNYAAEQ
HVVYFEDVTNQDVALTRNRIRHRVVPELMTVNPQLLKHVADYQQQLTTLLTAKKQMVTVL
LSQVVTATGALVVDQWGALPSQWQLAVFATWLEQQTQQLFTESKLQPLVSWGQRTRPATS
RLTVNAAWELYRNAGIIEALPIKKRGKKLMPREKIMVDLNQWQKITATQTVGIFTRVPNV
VSQPFWLTEADWPLVWRPWQAGDRIVLKGGGHQLVRRLLIDRKVPAERREQVQVLVNAQG
NVLWVVGHKFSYRTTGTQTVFLALKHES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]