dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|384218408|ref|YP_005609574.1| (Bradyrhizobium japonicum USDA 6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment O-acetylhomoserine sulfhydrylase [Bradyrhizobium japonicum USDA 6]
Sequence length 426
Sequence
MSDRLPGFSTLAVHAGAQPDPTTGARATPIYQTTSFVFNDADHAASLFGLQAFGNIYTRI
GNPTNAVLEERVAALEGGTAALAVASGHAAQVVVLQQLLQPGDEFIAARKLYGGSINQFT
HAFKSFGWNVVWADSDDIASFERAVTPRTKAIFIESIANPGGSITDIEAISTVARKAGVP
LIVDNTLASPYLIRPIDHGADIVVHSLTKFLGGHGNSLGGIIVDAGTFDWSTGGKYPMLS
EPRPEYHGIRLQETFGNFAFAIACRVLGLRDLGPALSPFNAFMILTGIETLPLRMQKHCD
NAKAVAEFLVGHPAVASVSYAGLASDKYNQLARKYAPKGAGAVFTFSLKGGYDAGVSLVS
KLQLFSHLANVGDTRSLVIHPASTTHSQLDDAAKVKSGAGPDVVRLSIGIEDKEDLIADL
EQALGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]