dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|193620273|ref|XP_001943812.1| (Acyrthosiphon pisum )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: similar to transcription initiation factor IIA gamma chain [Acyrthosiphon pisum]
Sequence length 112
Sequence
MSYQLYRNTTLGNTLQESIDEMIQYGQITPALGMKILLQFDKSVNNSLATRVKSKITFKA
GKMDTYRFCDNVWTFMLSDVEFKETQEMAKVEKLKIVACDGKSVTDENSKKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]