dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|193624660|ref|XP_001952666.1| (Acyrthosiphon pisum )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: similar to transcription initiation factor [Acyrthosiphon pisum]
Sequence length 814
Sequence
MPGISQVDFVGQQQQQQQQQQQQQQQHHHHVVNPTLAHNYAAPQPMKSLDQVKVVYSNSA
NSRNYVPVNSLPNGTINSTSTGSGTAVVIKSTSQQHHHNSPPVSTMTLPGQVSSNQSSVS
SNVITVSKQMAQGVVTGNSPQTILPANVQILNVNALRPQNSQGGVNKNMSRVMIPQVVGS
RPGAPGLTLQTLQQAQGGHILLKTENGQYQLLRVGPAPSQGNTITQNNANFRVQSVPSVA
TNNVSIAGTPTTTPTQTIAQPQQAHQKIQQDNTKEKCRKFLANLLELSSKEPKPVERSVR
TLIQELVDAKVEPEQFCDRLEKLLNASPQPCLIGFLKKSLPLLRQSLMLKEMVIDGIRPP
QLSAQPTVVLANQQQATNTQVMGNILSNAASNQQTVRIMTSQPALTPARTINSQQQHRIV
SQQVRVQTPQGLTAVNKMGSIRIQPPVATSQTTTLPPPLTSTSSPRPPVGGGRQMLVKAV
PLKTTPVGSHIKISTPLASTPLPTNSITMPQPRIPPSPNIIAQPTTINKISTPITVAPPI
VALSKPPSKEKEKKSFSSSAAYVGDDDINDVAAMGGVNLAEETQRILGSTEFVGTQIRSC
KDEILLPQNPLVAKIKQIVNREGLEDAAADVPALVSHAVAERLKDLLEKFAVVAEHRLDF
NKADKRYEITRNIRGQIKCLEEIDKVERKKQDEMERELLLRAAKSRSKNEDPEQAKLKAK
AKEMQRVEMEELRQREANLTALNAIGPRKKPKLEPGISPSLQNQNSSISTSLTNRQTIPR
QRIKRVTMRDTLFVLEQEKDIRRKANFMFKPFLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]