dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427716577|ref|YP_007064571.1| (Calothrix sp. PCC 7507)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine protein kinase [Calothrix sp. PCC 7507]
Sequence length 920
Sequence
MVSEHEPLEKIRVICTRPRKSDEPPHWNEIPAELLNSNEPEAVRRRAERKCEVCGMSLIL
QGRYVPISELGQGGFGRTFQALDCQFYTSEKSPEQQKIQRVIKQFRSEKFLNSVNLNRAE
KAFDREKNILAELEHLQIPTIFEYFKLQAEADIRPNNSQFQSNSSPINNNSYLFFIVQKY
VEGQDLNQELITRLKYNNRYLESEVLDILKQILNVLHHIHTRQEPVIHRDIKPANIVHSI
KEGKYYLVDFGAVKQIIPVVEQGFSDSETGFVTEGISPPEQLNRKVYPSSDLFSLAITCV
MLLTGKLITSDSHSSEDIRIFNIPYNRDKWQKYAQIQPGLTTILSKMLELDPKNRYQSAN
EVLQELDKLEKKPPFDWQRVTPVLKPFFIGAGALLVLLVLSQILPQSMKCNFQMNCLTRL
PEGEGTTGRTTSTSTYTPAPTSTVAADQLISAGNKRIYGSIKLTDNYERLKVEGIRLFDK
RQYQQAHDKFQEIRNQAKTIPQQAEQSETVRKKALAALQDPEVVIYHNNAIARLRHERGQ
PIYTIAVAIPVSDKSKTTFQPGKQILFGVAQAQSKALDQNINLEVVIANDLNSIDQAENV
AKKLATLEIKDKNGNSRKILAVIGHYTNPVTCKILALYENVGLPVISATSTLEDFRNRCG
ASNVFRTTSSTVVEAKSLVGYLRLRNIANPKIAIFFNGKEDYSRDLASQFQLNLGKNSNV
VVNDKLFDSNFSAVDAVNNVSNADVFVILPSGITENSDAFKNAIKLLEASQNNNLLKLIL
GANTLSSSEEYLNAQLLGKLAGKLFIAVDWHPKCSNNDFVENVKNKWAGGEVNQLTASSY
EAVQALEEALQKLPSTTAITRENLQQQLRNISLNSDVFKKKTISFDDRGDRNEIKTRILT
TPQENGQGFELAPGETCPQN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]