dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Trire2|75304|estExt_GeneWisePlus.C_30418 (Trichoderma reesei 1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 373
Sequence
MSLLQAVKYQRGKLEVLDQLLLPHEFHYDTVSTRQEAFDSIATMRVRGAPAIAIVASLGL
AVELHNNSIAGTSDGEVIAQIDEALDYLKESRPTAVDLTNAINQLKATIRTAEGKGKDAI
VQAFIEEAERIFEKDLQSNLSIGEHGAQWLQARAGASPDHKISVLTHCNTGALATSGHGT
ALGIIRTLQSKGYLKHAFCTETRPYNQGSRLTAFELVHEGIPSTLITDSMAAALFRTKKA
ENNIAAVIVGADRVVRNGDTANKIGTYQLAVLAKHHGIKFIVAAPTTSIDLETETGDGIK
IEERKREELTQISGAVRVATADQRIDVWNPAFDVTPAEFIDVVVTEKGAVEKGPDGTFDF
SQILPERWAKVVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]