dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428304133|ref|YP_007140958.1| (Crinalium epipsammum PCC 9333)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Cri9333_0484 [Crinalium epipsammum PCC 9333]
Sequence length 1192
Sequence
MNNRTLTLISCLLLLSTPVITASAIYAQQPNLTAPDDVPPPIPLQEKEKIAAEITVKISS
GNNGGSGVLIAKKQQTYLVLTNAHVVDNSKNLQISTPDGKIYTAQLVPNSKLGNYDLALL
QFTSNKEYSIAQYDPSNLPRMNGDILAVGFSGESGKLVYRPGKITYLPERSLKQGYGLGY
NSNVVQGMSGGAILNEYGELIGINGRSSYPILNSGYVYEDNAKPTPAEVQKLRGSSWGIS
LQTFLAQLPQDFARAYSFPQPPISIPDVNNEPELTGWLGQLNEQARKFTVRINNKNDDRD
SGSGVIIAKQNNTYYVLTCAHVIKNSTNYEIVTPDGKIYSVDYSRVRKEEGVDLAVVQFN
SNDSYQVATIGNVAAKDEQYTFVTGYSKFGNKQSQWRFSPGDISEQEVGLLRVKNYRVEG
RNQSAVAAESAISLTGGYELVYRNITYGGMSGGAVLDSLGRVIGIHGSAEGEIAIDDSSS
DLNKLQFGYSLGIPAKTFLGIANRLQVNSGLLKVENSPPPDLNAVQQDAVKKTILTVGVP
QGNAKASVWLQRGNQLWRLRRYDEAIAAFDAAIKLQPAFVHLAWYGRGLVLYAQKKYSEA
SVAISTAISKKPDYYPALKLQSQVLTQLKQLDEALVAIEKAIVIQPQDPNLYFIKTSILS
DLKRYPEAIATIQKGIDISPRAALYWIRGNVYVNQKQWDKAINDYNTAIKINPQYANAYL
MRGGVYSDQKQWDKAIDDYNTAIKINPQYANAYLMRGDVYSDQKQWDKAIDDYNTAIKIN
SNNAWAYSARGLVYYKQKQWNKAIDDYNTAIKINPGDAFAYSARGLVYKEQKQWDKAIDD
YTTAIKINPQYADAYSLRGRVHDQQKQWDKAIDDFTTAIKINPNNANDYSLRGLVYVNQK
QWDKAIDDFTTAIKINPHDAGAYSVRGLVYQEQKQWDKAIDDFKSAIKINPGDASAYLSR
GEVYSYQKQWDKAIDDFKSAIKINPNDALAYYNRGNVYVNQKQWDLAINDYNSAIKINPQ
YAEAYYNRGIVYSNQKKWELALADWNQAIKINPKFAEAYFNRGFVYHTQENYSAALSDYK
QALSINENLIAAISNIGFINYEMGETEAAIQQWQKVVKVDSQQAEPQLALAVAMYTKGES
DKGVQLAAQALKLDKQFADVAYLKQNLWGKRIIADTQKLFADAKMKAVLAGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]