dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

30167.m000858 (Ricinus communis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment translation initiation factor 2b, delta subunit, putative
Sequence length 638
Sequence
MDPRRASRTVSDPKVRQVGFFTPGASSPDRSQSGPPDPHPISSSPPTITDLSPSSGNSLS
PVMIPPPRHVSAPLSPLLRDSAPPGTMVNSNSNNATELFTAATSPTATTSFSDSGRGGTA
PSSSYPGGGGVGGLDMPQTSSSVPGSGLTTVSVFVNLPPGLDEKAGISTDVQNSNRSNLK
RLKEKTTKAERRALQEAQQAAKAAAKAEGAAIPANAKLAKSAKVPSQKNDNAPTAASEKK
GGEHPPEKDRKKDVPQPRMQYDDKSRVEKAKKRAVVKQTEARNRVELFRHLPQYEHGTQL
PDLESKFFQLDPMHPAVYKVGLQYLSGDVCGGNARCIAMLQAFQEVINDYSTPPEKTLVR
DLTAKIGSYVSFLIECRPLSISMGNAIRFLKNRIAKLPLTLSEAEAKATLHADIDCFIYE
KIIVADKVIVKHAVTKIRDGDVLLTYGSSSAVEMILLHAHELGKQFQVVVVDSRPKLEGQ
LLLRRLLGKGISCTYTHINAVSYIMHEVTQVVLGASSVLSNGTVYSRVGTACVAMMAHAF
HVPVLVCCEAYKFHERVQLDSICSNELGDPDAISKVHGRDEINFLGGCATSENMQLLNLI
YDATPSEYVSMIITDYGMVPPTSVPVIVREYRREHWWI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]