dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSRNOP00000024093 (Rattus norvegicus 76_5.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection chromosome:Rnor_5.0:1:247847960:247887886:-1 gene:ENSRNOG00000017878 transcript:ENSRNOT00000024093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 495
Sequence
MSSPAQPEVPAPLDNLKIQHTKIFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDHLLLATMESMNAGIFTHAYML
DTEVSIKALKYFAGWADKIHGQTIPSDGDFTYTRREHIGVCGQIIPWNGPLVSFIWKIGP
ALSCGTVISFEIKFLICLLFVSLLQAGFPPGVVNVVPGYGPTAGAAISSHMDIDKVSFTG
STEVGPFFGTISRPSYSLKKLLNDLKYFFSHVNVSFAVDSAVEFAHQGVFFHQGQICVAA
SRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGMSQGPQIDKEQHVKILDLIESGKKEGA
KLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKRANNTPY
GLAAGVFTKDLDRAITVSSALQAGTVWVNCYLALSVQCPFGGFKMSGNGREMGEQGVYEY
TELKTVAMKISQKNS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]