dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMMUP00000036776 (Macaca mulatta 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:MMUL_1:13:3109686:3147685:1 gene:ENSMMUG00000011872 transcript:ENSMMUT00000043788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 222
Sequence
QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGEKGDSGDIGPPGPNGEP
GLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETDSKIYLLVKEEKRYADAQLS
CQGRGGTLGMPKDEAANGLMAAYLAQAGLARVFIGINDLEREGAFVYSDRSPMRTFNKWR
SGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKESM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]