dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|108804408|ref|YP_644345.1| (Rubrobacter xylanophilus DSM 9941)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Rxyl_1571 [Rubrobacter xylanophilus DSM 9941]
Sequence length 492
Sequence
MSGSVDIVDTTLRDGNQSLWSATGLTTQDVLAIAPTMDRVGFHALDFTSSTHMGISVRFH
REDPWERIRLVSAAMPNTPLGLITTGMRFIRWVPAGEDLMRLAFRCWVRNGMRRIQIVDP
SNDPGALLRMARIAREEGFEEVVVGLTYSISPVHTHEYYLERAAAAARSEDIDRLYLKDP
GGLLTPDAVRALIPGFIERFAPRPVELHSHCTIGLGPLAYVEGLRSGVRILHTAVEPLGS
GSSNPPAGATLRNIEAEGLSCDLDTEALGVVSDYFHELARERGLPPGTPREFDGAYFRHQ
MPGGMISTTRRQLQELGRPELFDAVLEEVPRVRAEMGYPIMVTPVSQFVATQAVMNVISG
ERWSKVSDEMVRYFLGHYYDPPAPVDADVADRVLSMPRADELKHLKPITLEGARERFGRR
LSDEELLLRLTMPAEQVDAMVAERGRQRAPLVRPGRAPLVRLLHELSKRKSISYLKLEDE
RTGDTIVWRHGS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]