dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

001697349|e3wxxE1|109.4.1.731|E:1-151 (SCOP2 SCOPe CATH ECOD)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 151
Sequence
NEPAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEA
RFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSA
QLLAAAKPELAELAARAGIMLEVVKTKKDME

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]