dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|81299947|ref|YP_400155.1| (Synechococcus elongatus PCC 7942)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Synpcc7942_1138 [Synechococcus elongatus PCC 7942]
Sequence length 336
Sequence
MLHRPLPSPSALSSDCWTPFHARLHQLLQRRSLLPTRSRLLLAVSGGQDSLALVQLLRGL
QPHWHWSLAIAHCDHGWRSDSTANAEHLRQLADQWQLPFYCQRSPEPPRSEAAARTWRYQ
VLEAIAADIDAALLVTGHTASDRAETLLYNLTRGSHLQGLASLRWQRSLSDRLTLVRPFL
GFTRAETSKMVQQFQLPVWEDSTNRDRRFARNRLRLEVLPQLRQINPQCDRHLANTAELL
ADEADWLAELTEQVYQQSLSEKGLCRSQLAQQPIALQRRVLHAFLQDQLQRSPSTVQVEE
LRQLITAPQGSCSSSLPQRRVAVVAGDWLRLQSVDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]