dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|81299988|ref|YP_400196.1| (Synechococcus elongatus PCC 7942)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment rubredoxin [Synechococcus elongatus PCC 7942]
Sequence length 138
Sequence
MDTPEASTPLANTEPEPVEEGTPEAAAETSETKPLVFLDRHECRSCGYIYEPNEGDPRRQ
IAAGTVFEEVPSNWRCPICGSPRSQFRNIGPKGIPSGFSENLGYGLGVNTLTPGQKNLLI
FGALGLAVLFFLSLYGLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]