dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

162425.CADANIAP00001962 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Aspergillus nidulans)
Sequence length 1032
Sequence
MGVPALFRWLSKKYPKIISSVIEELPQEVNGEEIPVDITGPNPNGEEMDNLYLDMNGIVH
PCTHPEGKPPPANEQEMMIEIFKYTDRVVNMVRPRKLLMIAVDGVAPRAKMNQQRARRFR
SAQEAREQDEKKQEFQRMLAKQNGDKEQMLQEEVIQKTWDSNVITPGTPFMDILAASLRY
WIAYKLNTDPAWEKLKIIISDATVPGEGEHKIMEFIRSQRASPEHDPNARHVIYGLDADL
IMLGLATHEPHFRVLREDVFFQESKQRTCHLCGQPGHKAEECRGQAKEKNGEFDEKGKGA
TLKPFIWLHVSILREYLAAELYVPHQPFPFDLERALDDWVFMCFFVGNDFLPHLPSLDIR
EDGIDTLIAIWRDNIPLMGGYLTQDGRVDLKKAQLILQGLAKQEDAIFRRRRQAEERKLA
NEKRRKQEEKARNEERARKRRRSSPSYDAIESPTHAKPRSAGAAAAPPAGLELITPARGE
LARQTRELTHSMVVNRGNVYRANMANKSAAAVLKSKLLGGQDGQPSDDGESTAESDAQLD
AAGPVLGKRKADEAEVGQLGTETPDKPEPAKADELPPDTVRLWEEGYADRYYEQKFGVDP
QDKEFRHKVARAYAEGLAWVLLYYFQGCPSWTWYYPYHYAPFAADFVDIGDMELSFEKGT
PFKPYEQLMGVLPASSNHAIPKVFHSLMTEPDSEIIDFYPEDFPVDLNGKKFAWQGVVLL
PFIDEKRLLAAMSKKYPLLTEDEKARNTVGRDVLLLSESHPLYQDLVSNFYSKKQGAPKY
KLNMRVSDGLAGKVEKNEAYIPHSSLVSSLEEYGMPSLEDDRSIMVNYEIPKSTNIHKSM
LLRGVKFGPPALDNADIQATKSRAQHSGRSYGGAPFRGGRGGRMNYAGDRQSHGNDRPNP
FAAHLDPKFMPGANPGAPMGMPSGWVPPSGNFSRGPPPPPRGGTSYGYGSQQYGSYGGYG
QQQSYQQSSHSQSDYYGRGPPAPYNNGPADYYSGRPSGYGPQESRGGGYNRGGYRGGRDT
YSSSGHGGYGRY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]