dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

214684.CNA01410 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Cryptococcus neoformans var JEC21)
Sequence length 604
Sequence
MKKSVELSESESGIVRGGKRDEERHILARLEFASALHDAPAPPPAAPSHALHRRQGVLSL
RGRKAAARSPQKDTPVRPHTLQHPRTTARRRPARGKKVEETLPVRYPCSPPGGQAGSEAQ
DRQRKTRKGARGMEGAKAEGAGGDERDGRGKQAVEHHQVKKRFEAYRSVLRFPSLQITQD
TTPTCNQMPPDPPWRTPLGRTFFHLPSPVGEYTQHESNKAEGESAKGSSYTDILKRTFKD
FSDVSVGSDVEIVHLHRQYPPKASAAAEEELEEGELEQDDWTVDIEPMRGYVEDDSNSII
FDDDDDGEPPNEPADLPSFHGECWNCLQQGHSLTHCPYPRNHLQINHSRELFFYARDNLP
PPRTERYLHDYLNMRVTVQEKERRLELLGKFRPGKIGKELDHAARMLVDDSDSGEMLVDE
IQWDKREYEWIQNIAKWGYPPGWTTALNPIEFLKDRISSLEAYDTAYRLTPEPGEELVIF
GADDDEDDEGSSMRDVTLGNADEREKSKEEGDDGSEMSIVSDSPSPSSLPLSPASSRSPP
TPSDIPPPPSPPPDLPPPPPPPPCDLPPPPPPNRWADYHTDMFASSRLVVYDETRPFVLG
TYAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]