dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

370554.MGAS10750_Spy0854 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Streptococcus pyogenes MGAS10750)
Sequence length 56
Sequence
MRKYIEFKDEWKSAADHLNDFIDKNKYAKVTGDLWQGSDQVIAEQCFLKVLEEMQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]