dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

398578.Daci_0100 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Delftia acidovorans SPH-1)
Sequence length 484
Sequence
MPLALRDPSLLKNLCLIDGQWLAADDGSRIDVHNPATGEAVGHVPRMGEAETQRAIAAAE
RAFALWKQQTAEARARLLQRWFELMMENQEDLALIMTSEQGKPLAESRGEIAYAASYVQW
FAEEARRIYGSTVPAPWADKRIIVTKEPVGVCAAITPWNFPAAMITRKVAPALAAGCTII
VKPAQQTPLSALAMAELAQRAGIPEGVFSVITGSSRAIGGVLTASMAVRKLTFTGSTEVG
RVLAEQCAPTLKKMSLELGGNAPFIVFDDADLDAAVEGAMASKYRNTGQTCVCANRLLVQ
DGVYDAFMARLKVAVQALKVGNGLEAGVGQGPLIDQAAVDKVEELVADAVKNGAEVVLGG
KRHALGGTFYEPTILANATDRMRIAREEVFGPVAPVFRFKTEEEAIRMANDTEYGLAAYF
YARDVGRVWRVGEALEYGMVGINSGIISTAVAPFGGVKQSGMGREGGAAGIEEYLSTKYL
CMGH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]