dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

5911.XP_001019086 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Tetrahymena thermophila)
Sequence length 743
Sequence
MLQNQHLSYDNLISCQLSKSLNDECKIFENSLSQITSTTKNPFIKVKQVSVVDILKGDDL
DSIQSQSRITQSNLHQISQNCFQCEQNHDLDSSASQDSQQFSKTIHEGNNYKIENDHEIQ
VDLSYSDDNQKEQQTKNEISRELKKKKQNQLDGLVEQLVKKKRKNNIELGYINSKNIWKK
KWLGVLFYVSKFLYIAKQCQKVFRASLLTSFQLHLIGDISSDFEQNECYRSLFYGHLFAC
IWYYVGNQSEQGWIAFNQLDRSDIYSNYVCSYYYAVVTMTTIGYGDITAKTTGERSVMIF
LALLSCGIFGFTINSIGNILSDFKQKSDTYLTELGKLNKYLSFYQVSSEVQINARKYLKF
IHQEKHNNQLSSFQSLNNLSGDLQNQIKMEVISKQLKQIQLFRNILKEEIILQLSLQVQE
NIYQPEQIILGQNEVKEPTIYIINHGRVLKYSQYDLASKENSIVLSTFLKIIKQDNESYE
KFCYVKDQVIYQQYLSQINYSCLSCQSKSHTLKDCPSIFYNKRYVSIIKKYLQPEQQQKQ
QQDDNKKRKAKKKQNCWKLFDQNYSQAIDFQNNNINQLSFDECSQITEEDDQEESNINDN
NKDCIQEFNLVETETRKSIFTQNLLKLSEDRDHFNSHKTGDILNEDDCSIGNIGSELKPQ
IIIQSRKHNTYDFQKSEEMKKQSSNSIEQQQQQQEDDLFWQFQCNLVIDLEFKRCSDVSI
IKLNFTKDAIKINQFLQGELQKT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]