dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|15921909|ref|NP_377578.1| (Sulfolobus tokodaii str. 7)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein ST1609 [Sulfolobus tokodaii str. 7]
Sequence length 270
Sequence
MIKRGILDLVTASALWGTIGIVTQIGYEHNANVFQIILFRSLSSSLLVFMVFRNVKTILD
RISLIMGVVAVIFYETYVYSVNILGASLSAVFLYTAPLWVILASKVYLKDEINNRKILAS
ILVVIGVYLIYFSKISIVSIGWGIASGFTYALLIIYSRFMQIKGYKDQEILASQAFWSLP
FSLLFLILSPDLTGSSILTGIYLGIVATFLAYIFFYRGMRLTDSITASIISSLEPVFTII
FAIIILHQILTPLQFLGSGIIIFSSILISL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]