dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_Achr1P03300_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:1:2696990:2701522:1 gene:GSMUA_Achr1G03300_001 transcript:GSMUA_Achr1T03300_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence length 210
Sequence
MAVPGRRNGVMDEEDDEDDVLFDDGDALADLDLDSDVPPHLRALVEAAESGNVDALRSAL
DNHTGSIDEPVEDGDTVLHLSCLYGYFPCVQLLLERGASLESKDEEGAIPLHDACAGGFT
EIVQCMLNSAGSPDFVMQLLSATDIEGDTPLHHAARGEHLDVVKLLLAAGASPKKTNIYG
KIPAELADQETEVRSILIAATASADEVSCQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]