dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_Achr2P16670_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:2:17461174:17465498:-1 gene:GSMUA_Achr2G16670_001 transcript:GSMUA_Achr2T16670_001 description:"Putative Regulatory protein NPR1"
Sequence length 584
Sequence
MEYSHLTAVTALSDSDNCSSVHFSGEAAGAPDSAAPAAEVEALRRLSDNLGSAFQSPDFE
FLADARIAVGHTGDGRAPPLEVGVHRCVLSARSPFFREVFAKRGKGAAMPVRVELKELVR
EFEVGYDALVAVLGYLYTGRVAPLPRAVCMCVDEVCPHEACRPAVDFMAEVLYASFSFQI
SELVSLFQRHLLDILDKVAADDIPMVLSVAKLCDKSCASLLNKCIEIVVRSDLDVITLEK
TMPPDIVKHIMDSRLNLGLVGPEGSSFPDKHVRRIHGALDCDDVELVRMLLKEGNTTLDD
ACALHYAVAYCDSKITTELLDLALADVNHRNLRGYTVLHIAAMCKEPKIIVSLLTKGARP
SDLTVDGRKALQISKRLTNSMEYLRSTEEGEASPKSRLCIEILEQAERSDPQVGEASVSL
AIAGDDLRGRLLYLENRVALARLLFPMEARVAMDIAQVDGTLEFTLGSAANHSTGNRRTA
MDLNEAPFKIKEEHLARMRALSRTVELGKRFFPRCSEVINKIMDDDITEITGFGHNSSEE
KRRRFLELQDVLSKAFSEDKEEFDRSSLSSSSSSTSVGVIRTRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]