dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_Achr2P20930_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:2:20611461:20615658:1 gene:GSMUA_Achr2G20930_001 transcript:GSMUA_Achr2T20930_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence length 761
Sequence
MAVFSHSTGRGCGGGGGSGGRGAAAASQRLVEAAQRGDVRAAAECLADPAVDVNHVGAVC
LRGRRVEVALREEAADEVRVEWEELRTDASALFLAAQAGDLPFVRTLLEKGADVNQKLFR
GHAITAAVREGHAEVVEVLLKAGASQPACEEGVVEASLHGRARLAELLMGSDLVRPRVAV
HALVSAASRGFVDVVDGLIKCGVDANATSRLLLRSLKPALHTNVDCTALVAAIVGRQAAV
VRRLLQAGARMDAKVRLGAWSWDAATGEEFRVGAGLAEPYTPAWCAVEYFESTGTILRML
LQHHSPNAPHHGRTLLHHAILCGNPRAVDTLLSCGADWELPVRAGRKTEFRPIHMAARLG
LASVMQVLVDKRCDLSSTTDAGETALMLCARYKRGDCLRILASSDADLGRKSLAGASAAA
IAASSNWSVGFQHAVLDVIRSGTVPRSSDPSVFSPIMFAAQHGDVASLQVLLTQPDINID
QRRGNGYSPVMVAAKEGHVEAFRVLVFAGANVRLRSEAGETAIDLFRLNENHDMFEQAML
ELALEKGSAGGFHALHFAARRGDMAALRLLTKTGWDVNALDGDGYTPLMLAAREGHAEAC
QLLILQGARCDVETRRGETALSLARSNAKLGKEAESVILDELARVLVVRGDHVKKHTRRG
KGPPHGKVLRMVAAAGVLRWGSSGRRNVVCREAEVGASPAFVRNSKGRGDAREPGLFRVV
TTRKREVHFVCEGGEAAAELWVRGIRLVTRAASGKGGSELN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]