dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_Achr6P18250_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:6:12394803:12401252:-1 gene:GSMUA_Achr6G18250_001 transcript:GSMUA_Achr6T18250_001 description:"F-box/ankyrin repeat protein SKIP35"
Sequence length 620
Sequence
MEVECKTVMTREDCMHLVQERQPEKDFDENGGLRAVHDGDEGEKVDGSNVVLLPLPADDH
RISKDYACDGMKVGSRASNPLEELAVQTKEQGKNKQGKKLSRRDRMELGRLFQEAVSSHD
WELAESLVLLADSQTLNDVLCIALDAIWFLTTWGELNGITGLIKKIVSYGGSDFTRAILR
TSFFASCVYACHCRIMNLTDTVGIMAQRLHERLQECHGDEVLKAEAGMKVQKFTDWALKC
IGFHFRYQENRGGRKNNMIVEVQLQLSAFKTFLELAGDHLTGKDFTEAFDAACFPLTLFS
SSFDSGWALGISAIAVQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAERNSLD
IDVDLALVFASHYCKIGTMECLVDEGHAVDFLGPLVRASERGCMQVVQWFVNRGCGDMEL
CLALTAATSSSQVGVSAYLLPHIPQHVLAALSIEILKAAGERSRGSLDGVAFLLCSDFLG
DPAATYAVADSIARSNDEAVAPELRAFLLEQWSEAAFAEGLSSGQDHFVNFMRILRRGCS
PICLMDLPPPLAATIAYMPLYRECMEAGGQLLSQKLRGQLVEAARRIGGRWVDDDSQANE
LLEILERNLPRFFLQPLTTL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]