dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_AchrUn_randomP20880_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:chrUn_random:101181028:101184190:1 gene:GSMUA_AchrUn_randomG20880_001 transcript:GSMUA_AchrUn_randomT20880_001 description:"F-box/ankyrin repeat protein SKIP35"
Sequence length 605
Sequence
MTPEDCMCLVKERQPEKEVDENGGLGPAHDGDEGERVDGSNHLFLREAPILTEESGISKD
YNCQDKKVGSREELVLRKDMCKQGTKLSRRDRVELGCRFQRAVSSCDWELAWNLLVLAKA
QALNDVLCVALDSVWFLTTHEELDGITGLIKKIIGDGANDFTRAILRTSFLASCVSACQS
KMMNLTDAVGVTTQRLHERLQECQGDEVLKVEASTKVQKFTEWALKCIRFHSHYQENRGR
RRRNQSTIVEVQLQLSAFKTFLELAGDHLTGKDFTEAFDAACFPVALFSSSFDPGWASGI
SAIAVQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAQRNSLDIDVDLALVFAS
HYCKIRTMECLVEEGNAANLLGPLVRASERGCMQVVQWFVNQGCGDMDLCLALIAATSSS
HLGVSAYLLSQIPHHVLAAVSIEILKTVSERSRGSLDGVAFLLCNDFLGDPTATYAVADS
IASSNDEVVAPELRAFLKEHWSEDAFAEGLSSGQDHYVNFMRILQRGGSPICLMDLPPPL
VTAIVYKPLYRECTEAGGKLLPQKLRGKLVEAASRLGGRQVDNDSPAKELLAILEHHLPR
HFLPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]