dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_AchrUn_randomP23670_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:chrUn_random:115895109:115903352:1 gene:GSMUA_AchrUn_randomG23670_001 transcript:GSMUA_AchrUn_randomT23670_001 description:"Putative Calmodulin-binding transcription activator 3"
Sequence length 917
Sequence
MHIVLVHYLEVKGHKPSFSRNREVEDVPQDNQVDSPVSSNSITNHSQLPSQATDVESPIS
LHTSEYEDAESAKFDAADNYPTSSRYHPFVKMQQYDDGQMTGVQFVDSYVPDPSIDSQCG
FQEIHDAEPKSDFYSVTQEDIGRVFNETGLGLTFIGSKTQLDLASWEEVLEHCATSHQMP
SFQSSAGITEVTTEEISSKQTSVHADLYAENPGTRQDDSIISDKFEWQLSSADTDSAIIS
TINMENETSIDGSDKYTSLVKQPTLDLSRVQTEGLKKYDSFSRWMSKELGEVDESHTKSS
SGAYWSAVGSDGIVEDSSISNHEPLDAYIMSLSLSQDQLFSIIDFSPNWVYAGLETKVLI
IGTFLKTQDVENCKWSCMFGEVEVPAEVVGDGILSCHAPPHKSGRVPFYVTCSNRLACSE
VREFEFRVSDPHCIENIDSCSNNTYEMLLHMRLDKLLSLGPLDSQSLDYRKKAHLGGKIS
LIKMEAADDTLPKISQENGYSADNAELLEMLLQEKLHIWLLHKSAKDDKGPNIWDEEGQG
VLHLAAALGYDWAIEPTVTAGVNINFRDAHGWTALHWAAFCGRERTVGALITMGAAPGLL
TDPTPEFPSGRTPADLASANGHKGIAGFLAESSLTSHLSSLTLDPKGSDIADVASLTGID
DAEQRALAVADGDMQAGLSLKDSLSAVRNASQAAARIYQVFRVQSFHRKKIESGGDKSAM
SDERALSLLSIKSQKTGHSDMPMHAAAIRIQNKFRGWKGRKDFLIIMQRIVKIQAHVRGH
QVRKRYKKFVWSVGIVEKVILRWRRKGSGLRGFRSEGVLEGTSMQCHLAKEDDYDFLQEG
RKQTEARMQKALARVKSMVQYPEAREQYRRLLTVVTEFQESKALQESIMDVSEDAADAHL
MVELEELLEGDTVMPTV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]