dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSMUA_AchrUn_randomP23720_001 (Musa acuminata 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:MA1:chrUn_random:116628504:116636388:1 gene:GSMUA_AchrUn_randomG23720_001 transcript:GSMUA_AchrUn_randomT23720_001 description:"protein binding protein, putative, expressed"
Sequence length 532
Sequence
MVCCDVCERWVHCLCDSISDEKYQQFQADQNLQYKCAACRGDCYQVEDIDDAVRELWKRK
DIADNDLIASLRAAAGLPSHEVTYSISPYSGDEQSGPIILKNDNNKPLKFSLKGISDKSS
EYENTTSNKKQVKKKGYWIKLVGKTEEAYPELDKQDETRSLECRYRDQNIDEMTTFRPDG
PDILSSSAARDPNGNGVKSCTNQLGTFDQSMAKEPASSNADMIPKVKIKSSKLQGLHFKE
CADKSANKIETTRSTKLVIHIGSINRNASNSPKSETSSCHKDQDLVNCFGAKMVNANVMR
TPKHGVKEKTKVKIGKVYVKPQKSNGNVTDECDLNATDLSVERMNEANFAAENDTTERSN
KVCQKKHSADIYVKPQRDSSEMSPSDFTSSSSKDLKTSLKLKFKNPCFEQKSSWAPHGEE
DNTVKGQRSKRKRPSTEKMGGWQDDRSSKLHLENLIDEAMDANWILQKLGKDAIGKRVEV
QPTNSSWHQGVVIDVNQSTSSLSVHLDDGRSTLLELGKQGLRFISQKQRTKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]