dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

APC64212.1 (TargetDB )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment $ MCSG $ SQ178051 $ PDBT89515 $
Sequence length 108
Sequence
SRMMVIKNNSEETKSREYIVIGQVFFASSDKFIASFDFKEVIECVTIDLSAAHFWDITSA
SALDKVVVKFRREGTQVELIGMNQATKTIVDKFGVHDKPEEVEKLLAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]