dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FR710 (TargetDB )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment $ NESG $ SQ151134 $ PDBT149484 $
Sequence length 549
Sequence
MASAMLATLELDYFRAVSLYRRRSYERCAELCNALLQAGHDGHVQLFTTKEEEEEEQHQQ
QQAEHSRFGSNLQRIGPRPRGAAGGGAGAVDSGPSIMMPTWLMEGVWQLKMRALTQRVYV
DDLDEDDGGNEATEEVEFERIATAARPGSSIKTAFQPRPLTSQRAQQARSRGAGVAHSSD
GRLNSSRPGSAAVARPGTSLSRPGSSLGSRCGTASRIRATSAAAFNVGDATSKLYQASRL
NPTIYAERETLVKALFQFLYYHEADVQKAHSLCQAVLEVERQKPSGSTGCTLSWWWQQQM
GRCLLALHYPRRAEPFLQQSLTSFPHPDTYLLLSRVYQRIKQPERALLVIGEVVDSRPFD
VTYRLEQARIHQAMEQQEDALQLYRLAAKLHPINVESLASIAVGYFYDNNPEMALMYYRR
ILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQRALATATQPGQKSDIWYNLSFVAVTSG
DFNLAKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYLNAAKDVMPDAAEVTTNL
QFMDVHYKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]