dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

IPRv3687cPALZ (TargetDB )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment $ SPINE $ SQ75321 $ PDBT330658 $
Sequence length 122
Sequence
LSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLG
SVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRI
DR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]