dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PlR35 (TargetDB )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment $ NESG $ SQ92539 $ PDBT132101 $
Sequence length 288
Sequence
MKKRLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTRWFAKQYQVDMSEAQVEDVTAY
EHFNAFFTRALKDGARPLDPTPGAVLSPADGAVSQLGPIEHGRVFQAKGHSYSVLELLGG
DPALAQPFMGGDFATIYLSPKDYHRVHMPLAGTLREMVYVPGRIFSVNQTTAENVPELFA
RNERVVCIFDTERGPMALVLVGAMIVASIETVWAGLVTPPKRELKTVRYDEAARAPIHLE
KGAEMGRFKLGSTAIVLFGPDQVQWAQELAAGSPVRMGQGLGLGLPKA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]