dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|392373250|ref|YP_003205083.1| (Candidatus Methylomirabilis oxyfera)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein DAMO_0122 [Candidatus Methylomirabilis oxyfera]
Sequence length 333
Sequence
MCRRSRLFRLASAALLFGVGTTASVRAEYAYITNQGDDSVSVVNIEKGEVIATIAVADAP
VGVATTPDGTHLYITHPEAGLISEIDTVTRTVVKTIDTGGQPFGIAVDDTAPVAGNNAQT
RRLLFVTDWSRNAVMTVDPVRGVVIDLIHAGKSPAGIALDRRARRVFVANRESNTLTVLD
ADVPRRYADIPTGRAPFAVALVPNGERVYVGNVQSGELTVIDAKALDVVATVKVGRFPYG
IAVTPDGARVVVANQQDHNITIVDALSLRTVGNIRVGRHPDGVDITGDGSHALIANWFDD
SISIIDLSTLKERTRVKAGKGCRAFGSFIVRNR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]