dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Tbg972.10.13410 (Trypanosoma brucei gambiense v4.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Trypanosoma_brucei_gambiense | product=deoxyribodipyrimidine photolyase, putative,DNA repair enzyme, putative | location=Tbg972_10:2598706-2600412(-) | length=568
Sequence length 568
Sequence
MYVPSRVVAVKRQRTPSQPLPAAVFIFRRDFRVTDNTGLLLLIERAGKQSLPVIPLFFFN
PRQCDPDKNPYFGKACFEFLCQSLKHLDTVQLGGRLVCLRGSDCDCLEVVRSSGYDIKQL
GFNRDITPFARKRDLQLEEWCVKRGVRCVTSNMDYTLLPPDVVTNKNGKPYRVFSPFYRA
VLQEHFSDIQAPNPKATTIGDIFTGSHVKEDVKATVDQARRSAMAADEFSSLVDYVDLAA
LPQTFPELVDRGGRSEGLLRLASVASAKNYSAIRDDIPGDKTTHLSPHLKFGTISIREAM
QVALLHLGKEHAFTRQLIWREFYSMLLYHNPRLALGQLKMDVALQGERQCRATLANEPFL
EKYSNFQWEWNDAEFTAFKSGATGFPLVDAAVRCLTKTGWCHNRCRMLIANFLVKVLFVD
WREGERWYATVAVDYDVANNSGGWLWSSGQGADAQPYFRFFNPFRQSAQHDPQAVFIKQW
VPELRNVSVRTIHKWDVFCKEGRPADEGTLGTVQGTVKESNGIKKEKTELPLGGSIVGGS
AYPSPIVDLKQRTKWIVERYKKHAAEVI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]