dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|488653103|ref|YP_007924906.1| (Salmonella enterica subsp. enterica serovar Typhi str. Ty21a)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence length 556
Sequence
MSVSAFNRRWAAVILEALTRHGVRHVCIAPGSRSTPLTLAAAENPAFIHHTHFDERGLGH
LALGLAKVSQQPVAVIVTSGTAVANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAI
RQAGMFASHPSQTLSLPRPTQDIPARWLVSTIDNALAMLHAGALHINCPFAEPLYGDMND
TGLVWQQRLGDWWQDEKPWLREARRLASDKQRDWFFWRQKRGVVVAGRMSAEEGKKVAQW
AQTLGWPLIGDVLSQTGQPLPCADLWLGNAKAVTELQQAQIVVQLGSSLTGKRLLQWQAT
CVPEEYWVIDNIEGRLDPAHHRGRRLVAKIADWLELHPAEKRKPWCVEIPRLAELAWQRV
VAQRDTFGEAQLAHRIRDYLPEQGQLFVGNSLVVRLIDALSQLPAGYPVYSNRGASGIDG
LLFTAAGVQRASAKSTLAIVGDLSALYDLNALALLRQVSAPFVLIVVNNNGGQIFSLLPT
PQSKRERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTPATTVIELVVNDT
DGAQTLQQLLAQVSHL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]