dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|22299603|ref|NP_682850.1| (Thermosynechococcus elongatus BP-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L33 [Thermosynechococcus elongatus BP-1]
Sequence length 64
Sequence
MAKAKGARIIITLECTECRTNPAQRSPGVSRYTTTKNRRTTTGRLELKKFCRYCNKHTIH
REIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]