dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|571028784|ref|YP_008900904.1| (Thermosynechococcus sp. NK55)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pentapeptide repeat-containing protein RfrA [Thermosynechococcus sp. NK55]
Sequence length 398
Sequence
MGEDKMTLRENQTAAALRLSKVLAARNRWRTGWQSLRSVLMPIAMVTVVVAWGLDWDALG
VVAALVLGGLSFPLVWTSTYHWFTEDLTEQQRQFILAALGLSLTVVALIAMTGAMDWIRA
RFQGTNWDAVGALAEGFGALGQILVALLAAYVAWRQYVISRDLTIQQNRITQQQTIDSYF
QGIADLILDDEGLLEDWPPERAIAEGRTAAILAGLDAEGKAKIIRFLSGAKLLSPLKRDR
RLGRAIFDGLGGYEEDIEYGVRVINLGSMLAGADLSGTDLRWTELSDANLTGTLFRNCNL
TRANLAGAILQGADFTNADLSRVRLFYGTVEQASPRDRLNPPNFRTGAQTGAVVEDVNFT
NVKNLSEEQRYYCCAWSGSRSRETIPGGCEGVPNKLGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]