dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|340622449|ref|YP_004740901.1| (Capnocytophaga canimorsus Cc5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Ccan_16780 [Capnocytophaga canimorsus Cc5]
Sequence length 126
Sequence
MKKQIIFTEKAPAPIGPYNQAVLAGNTLYVSGQIPVDPQTGEVVKGVEKATKQVMENLKA
VLEVAGATFENVVKTTIFLTDMNDFAQVNAIYGEYFDDATAPARETVQVANLPKFVEVEI
SCIAIL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]