dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTRUP00000014141 (Takifugu rubripes 69_4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:FUGU4:scaffold_390:64657:75272:1 gene:ENSTRUG00000005804 transcript:ENSTRUT00000014206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 751
Sequence
EMQRVGAKQYLVARALYSEDSFAEEHEKVCRPHKTTLDHVKQYFKCDAKRAKNTALSLLP
IVGWIKIYRIKEWLLNDIVSGVSTGLVAVLQGLAYCLLASLPPWYGLFSAFFPVVIYFFF
GTSRHISVGPFPVLCLMIGSVVTRLVPDEGPPVNITGFEGLTRDEQRVLVASSVTFLTGI
MQLAMGVLQVGFVVMYLSDTLVSGFTTAAAIHILVSQLKFVLGLQVPGISGPLAIIYTLE
IIFAKITSTNVCDVVIALVIMVVVFIVKELNDRFKSKLPVPIPIEVIMTVIACGVSYAFD
FRVKYGIDVVGYIPQGYESPIAPNLHIFKETAVEAFPMAIVGFAVAFSVAKVYSVKHDYT
IDGNQELIAFGISNIFGASFKSFAASTALSRSAVQESTGGKTQIAGVLSALIVMIVTLAI
GFLLDPLPKSVLGAVVIVNLKGMLMQVREIPYLWRRDKPDCVVWLGTCIASILLGLDLGL
AVGLGVELISVILRTQFPRCSVLANIRGTDIYKDRKDYTNIIEPKGVIIFRIPAPIFFAN
IEFFRSKLTEAVGFNPLKVLRKRNKALRMIRKLLKKGDLQWTSKGFLNTSFQPITESEDE
SNMEELDMSIDFKDLPVSIDWNADLPANISVPKLDLHSLILDFAAVSFLDISALKGLKTM
LKELIRIEVDVYIVACDPYILEKLHDCCFFDDEIKPSIFFLTLHDAMVHVLEKHPECEDK
NTQDDTQIITSVTVHYPDLRNRDRNVFSCQC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]