dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|13541613|ref|NP_111301.1| (Thermoplasma volcanium GSS1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment mevalonate pyrophosphate decarboxylase [Thermoplasma volcanium GSS1]
Sequence length 359
Sequence
MDLPGIVSLLKEKGLYRAPGKYRKEMRYGEIHYGSGYPITGLIKFLGYYDESLKIANFPS
ISLNTDVSEAYSAFMISKDNGNDTAVVEGENSPNITKKAMTAINVFKNLYDIKGSFHFYL
RIKRKYAGAKGLGESAAVAAAASRSLVSALFEKEALKDSNFISIVARLASGSGSKSVAGP
LSLWLTAPAVSHEGSFSLNLRKEIDDIFLCAVPIRDSVSTAEAHNTVIKSPFYQQWSRLQ
FDAVYSIISRGGYSAQIIENATTNTYLMHSVLISTGKLLWNQDTLRAMGIVEDMRRIGRL
IGFSIDTGPSVLVMADREDLIKEFKERYNGECIDASVPNGAPDIPSSFVESAERYFAKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]