dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|13541719|ref|NP_111407.1| (Thermoplasma volcanium GSS1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment kinase related to galactokinase and mevalonate kinase [Thermoplasma volcanium GSS1]
Sequence length 324
Sequence
MIITKTPLRITFVGGGTDIPEYYRKKGGAVVSAAINKYIYVIVNKKFDNKIRISYSKTEM
VDSVEDIEHPSVRESLKLLGIDGGIEILSISDIPSKGTGLGSSSTFLVGLLNALHAYKGE
LTSREELAREAVLIEREILKEPGGKQDQYMAAYGGINLMNFNQDESVYVRPLSINAKSLE
DFRNHLLLLYTGIQRNSTDIHKKQREEVIKKEEYYDEMKELAYTFFEAVYKAEYPRIGAI
MDANWKNKKKLTDGISNDIIDNLYELAMKKGAYGGKLIGAGGGGFLLFVCEPSDSDDIIK
ALSLRKIDFDFDFEGSRIIYVSKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]