dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|13541837|ref|NP_111525.1| (Thermoplasma volcanium GSS1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment homoserine kinase [Thermoplasma volcanium GSS1]
Sequence length 306
Sequence
MELSVISPCSSANLGPGYDVLAIAFDAFYDQVNVMLSDKLRILADEIPVQPDKNTAGLTA
LKMIEDFGIKDGIKISIKKGIPYGLGLGSSGSSAAAAAYAINNLFALGLERKDLIKYAAV
GELASSGSPHPDNVSASILGGLVIVSPEGISAKRIEVSDQFKFLLVIADLKIRDKTKYAR
SLVPSGVSMGDHKRNTSRVASLIAGLMSGDRELVSTGMNDDIVEAAREPIFPYYRRVKDT
AIESGAVGAVVSGAGPSILVVYDNKTETKQMIRKISRIYEGMGISVNFATPNVADGVREV
ANPLAD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]