dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTBEP00000005301 (Tupaia belangeri 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_843:1223210:1312130:-1 gene:ENSTBEG00000006127 transcript:ENSTBET00000006157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 792
Sequence
MRVRIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSLPSDESVKGPTTAGRVVAGQIF
LDAEESELEPSIQEEDSLKSQEGEGVPEEINFLDSPNPENKDYEESKKVRKPALTAIEGT
AHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATSYDYKTDEKWGFCETEEEAAQRRQMQ
EAEMMYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIHA
AKEMFEKLTEEGSPKGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLI
QYYQFLAEKGDVQAXVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKXXX
XXXXXXXXXXXXXXXXXXXXXXXGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQG
WVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHT
AVELVKHVCERGRWSERLMAYHSYKDGDYNAAVIQYLLLAEQGYEVAHSNAAFILDQREA
TIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQH
SAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGIVYFLQYIR
ETNIRDMFTQLDMDQLVGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPVPRPPGPRPAPP
QQEGPPEQPPPQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]