dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTBEP00000013421 (Tupaia belangeri 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_637:379116:555354:1 gene:ENSTBEG00000015444 transcript:ENSTBET00000015467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 701
Sequence
MASDIPGSVTLPVAPMAASGQVRMAGALPARGGKRRSMDFDDDGEPSKSRENHSEIERRR
RNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTE
QELKHLILAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLR
EQLCTSENSMTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGNAPLDHLPLNRI
TTMRKRFRNGLGPVKDGEAQYAVVHCTGYIKAWPPAGMTIPEEDAEVGQGSKYCLVAIGR
LQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDILEFCHP
EDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNT
NVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEKKMMSSASAAGSQQIYSQGSPFPPGHSGKAFSSSVVHVPGVNDIQSSSST
GQSMSQISRQLNQGQVAWTGSRPPFPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]