dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTBEP00000013571 (Tupaia belangeri 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_442:30506:50781:1 gene:ENSTBEG00000015634 transcript:ENSTBET00000015632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 491
Sequence
RPLRFRIQQLEALRRMVQEREKDILAAIAADLCKSEFNAYSQEVITVLGEIEHVLENLAE
WITAKPVKKNLLTMMDEAYIQPEPLGVVLIIGAWNYPFALTIQPLVGAIAAGNAVIVKPS
ELSDSTAKILAKLIPQYLDKDLYAVINGGVEETTELLKQRFDHILYTGNSVVGKIVMAAA
AKHLTPVTLELGGKSPCYIDRDCDLDTVCRRITWGKYMNCGQTCIAPDYILCEASLQSQI
VQKIKDTVKEFYGENIKESPDYERIINMRHFKRILSLLEGQKIAFGGETDEASRYIAPTI
LTDVDPDTKVMQEEIFGPILPIVPVKSVDEAIRFINDREKPLALYVFSRNDKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSSGMGAYHGKHSFDTFSHHRPCLLKSLKGEGANK
LRYPPNSQSKVDWTKFFLLKRFSKGKLGLLLLAFLGVLAAVLVKKSHAVLRRKALLTFLV
AHRLRRSREQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]