dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|442555651|ref|YP_007365476.1| (Lawsonia intracellularis N343)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M23 [Lawsonia intracellularis N343]
Sequence length 437
Sequence
MSKTKLLVITIGIASIILAAATYIFFKNTDPPIISMIQPTQYISPRQPLTLTITSKYSPL
KLIQIIVKQNEYTKTLINQPIINGHLIETVDIDFKKSGLQDGPFELIVKAQDSSYSNFGK
GNISNKTWDMNFDSQPPQITIHSPTPSLHKGSATAIAFTVSKPVAVIGVQLEEKFFPAFQ
QANGTYYCFFPFPIEFSPKTFNPKLFAQDLAGNKSYISVHVHSLERSFKIDTLTITDTFL
DKKMPNFEQNFPDTQTQVERYIKVNSILRIENEKKLIEISKKTSPMMLWSGKFHTLPRAA
VKATFGENRTYMYQNQKIDQQFHMGLDLASTANAPIPAANDGIVVYTGDLGIYGNIVIID
HGLGLQTLYSHLSKITAKEGDVVKKGDLIGYTGMTGLAGGDHLHFGFLVGGIQVNPIDWL
DPKWIKNTIITRLNNNV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]