dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|345011461|ref|YP_004813815.1| (Streptomyces violaceusniger Tu 4113)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PHP domain-containing protein [Streptomyces violaceusniger Tu 4113]
Sequence length 581
Sequence
MARSNEEVEALLREYADLLLITGGDAYRARAYEKAARAIGGHAADISQFDAKALRDIPNV
GRSTADKVVEYLRTGTMPAVEEARAAIPAGVRELTAIPALGPKKAMILYEELEISSVDQL
AQAIEEHQLRDLKGFGPKSEENILHGIALMRAAGDRIPLDEAMDVADDIVAALSKVRGCR
RCAYAGSLRRMKETVGDVDILVAAEDSGPFMEAFTGLPLTAEVIAHGQKKTSIRTTKGLQ
VDLRVLPLDSWGAGLLYFTGSKAHNIRVRAIAVRHGLKLSEYGLFETKSGKSIASRSEED
VYARLGMDWIPPTLREDRGEVKAALEGQLPKLVTESDLRGDLHTHTNLTDGLEPLEDMIT
KAERRGYAYYAITDHAPKLYMQQMTEEKMLAQRERVRELDRGRGRGHTRLLHGVELNIDT
EGDVDWPPEFLEDFDVCVASVHTQFGMDRKAMTRRLVRACENPYVHVIGHPTTRLIGKRP
GIDADLDEVFAACARTGTALEINAHPDRLDLSDDNILRAKSYGVVFALDSDAHSTRDLDN
MRYGVGVAQRGWLTPDDIINTWPLTRLRRFLRKDKGQQPSP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]