dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gb|TGME49_106310 (Toxoplasma gondii ME49)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Toxoplasma_gondii_ME49 | product=structural maintenance of chromosome domain-containing protein | location=TGME49_chrIX:6029584-6050001(-) | length=1523
Sequence length 1523
Sequence
MHIKEVTIRGFRTYRHSTTIHFSPGYNCIVGANGSGKSNVLLAIAFALGEGGQSSTERRM
LLHEGMNERVSDGSVQVVLANEDRRLCMYDDDEVQIRRVFSATTDDSFVQGKRISKSGLQ
QLLECAGFARGRSGTASSIASTSTAYFIQQGRIVQIALQSGAERLALLQTVAGGASFDAK
TREIETLMRVGATEAGRIESQVKEIGEKLAEMSSERRELNECVHLEEEKEKIDYVLAELA
WREAASYLETHARACAEQTTRIESLEERLEGAESLREDLEKQRELLKTQVSRQTALRDEA
ANVQTELRAEEEKLRLEANLWEKKEEAEIQGDAERDEKLRDLKEKLRIAEMKLANELRPS
LDETQKKYQELQQRFQQAQQQLTALQCKRGILAARSHMQRGSSSRKSTSKEVSGGAKEAP
RCSDADVQREIKQAEHLRKEETEMIKTLTAQIEALTRERAELEADREASQHGQAKAAEEL
RETEAAQRDLSKAFEEALEELRVHQAQLGELLQEYTVAKDALASAEDRFWQQLRTDVREG
LHAAIDFARSRGWSTRTREKLEKQTSSTAPERPRNSSGDDTPSPEKQCEKTQMPAGMLLD
FIHVAPEYRRAVEAVGAHALTAFLVPDARAAEDLLSYLKSRKTRACGSSVLGRRSREEEA
KRDERSGCVQEGKPNVSITVVPLKEVAELQREKEELSRNKARRTRIRTLTEEGKCMPLVE
CVDVQLSYSASSSADGQQEGDSGVELVSAYIRSVLGRAMLVPSLAQTDDGLVSSLHEKGL
DCVTVDGDVGFASGVVRGGGVMPSFLSSHADQQSRDLWAQPACGKLQAYRNLRQRQEQLD
RLGQQIEEKRKRLAEVESRHDAFIEKEQLLSETRARCQANLEEAVASRQQIDGRLRATMD
LLAAVEEGARQATQRVHGIKTLIQNLRRENVSPDTAGLSLSEEKDATRLPGEIRAMEKEM
ALLKDEAEQREREVREASSEVDFHLRKQVERLEREEARGRRSEAREKRQEVEERLAAVNR
RMLQEEEVSRKCERRLRVLEEELEEKEGELDLAEKQRQGIVAQIEDALKTLQISKRAAES
AQRAKDDAETLLAATGAAAAAAPDVSQLRLLSSRELAVKLGAVKKKLEGYSHVNRRAVEQ
FSNLQDDFMDLQQRESRQKGTQEAIREQLKILVRRKKKAVLASFDRVNEEFQKIFATLVP
GGRAEMILQHSLLPDNAHGCFDDDAVQCAKGRDEKTRHRSNSLDAKARGQASRDKRFEME
HEEAKAGGEEGKEGDDGGASLIGVDIRAAFSDAGALTASTRGGADRANHQLALLNSTGGE
NRKDKDGRTHGMNQLSEAVAQACRFWEAKEELLSFSPLCCCLSRELLSGGQKSLVSLALL
LALQRVSCCLSSSPSAEFSAGEEVKETPGGVLLLDEVDAALDENHRRAAAQALAQTASRR
ISQVILTTFRPELLSPADALFHISQENRVSYVEEIDLRAAMDILQEQQGEEIALHEEASR
RMERDSDARLRGLPLTFPPLPAH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]