dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A009FPX6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A009FPX6|A0A009FPX6_ACIBA) Sulfate permease family protein {ECO:0000313|EMBL:EXA65257.1} KW=Complete proteome OX=1310605 OS=Acinetobacter baumannii 348935. GN=J504_2130 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence length 559
Sequence
MTLKSDVLAALIVVAMLVPQGMAYAMLAGLPPIMGLYASILPMIIYALLGGSTTLSIGPV
AIISMMTFTTLNPLFEVGSPVYIEAATLLALMVGIISLLLGVFRFGFLIQLISHPVIQSF
IIASALLIAFGQFKFLVDLPLKANNIPELVKSLVEYLPLLHLPSLIFGLLSIGLLVYLPK
LLKSQAIQSRIGSTDFLVRAVPLILVFLGIAAVLFFDLKVQGIKTVGEIPLGFPPLSFPH
WNWELVMTLLPGASMIAMISFVESLSIAQATALQQRSNLNSNQELIALGVANISAGISSA
FPVTGSLSRTVVNADAGAKTPLAGVLSSLLIVVVSLFFTSFFEDLPLTILAATIIVSIWK
LVNFQPFVDAWRYSKADGIAMWITFFGVVLLDITTGLIVGIISTFILMLWRISRPHIAVV
GLVEGTQHFRNIQRHQVMTSDRVLSLRIDENLSFLNAHTLKGYLINQLSLNDKLEHVILN
CSSISAIDLSALETLEELNAELSKLDIRLHFAEVKGPVFDRLQASKLMTHLSGRIYLTHF
QAIQDLAPEIFEKPQHYMI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]