dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A011ND54 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A011ND54|A0A011ND54_MANHA) Uncharacterized protein {ECO:0000313|EMBL:EXI62457.1} KW=Complete proteome OX=1450449 OS=Mannheimia haemolytica serotype A1/A6 str. PKL10. GN=AK33_04225 OC=Pasteurellaceae; Mannheimia.
Sequence length 107
Sequence
MPQKTLQWDIQQNNESLFVRLSGELTRNTLLPLWKQRASFLSPKANQHLYWDLKEITRVD
SAGFTLLAELLNHYHKIIPNSLINIPDSVKTLADLYDLDGWFEQFII

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]